DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and sec14l7

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_009303977.1 Gene:sec14l7 / 566865 ZFINID:ZDB-GENE-141216-145 Length:405 Species:Danio rerio


Alignment Length:280 Identity:70/280 - (25%)
Similarity:123/280 - (43%) Gaps:50/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QAIKELRELIQN--EKYLNLPLDDEYMMMFLRP-THYYP--ESALKRLKNF-YHMKLKYGAACEN 110
            :|:.:.||.:::  ::..|  ..|.|::.:||. |...|  |:.|::...| .||||      |.
Zfish    27 EALTQFREKLEDVWDQLSN--QTDHYLLRWLRARTFNVPKAEAMLRKHLEFRRHMKL------ET 83

  Fly   111 II----PSKLRNVFEANILNLLPQRDQHGRRL------------LVLEAGKK-WKPSQVPLVDLF 158
            ||    |.:   |.|..:...:...|:.|..:            |:|.|.|: ...:::...:|.
Zfish    84 IIDDWSPPE---VLERYVAGGMCGYDREGSPIWFDIIGPLDPKGLLLSASKQDCLRTKIRDAELL 145

  Fly   159 R---GIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKAVH 220
            |   ..|...||..:|..:      :|.|.|||.:.|:.:........:|...:|.....||.|.
Zfish   146 RRECEKQSKKLGKHIESIT------IIYDCEGLGMKHLWKPAVEMYGEILTMYEENYPESLKKVL 204

  Fly   221 IVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLI-SHIEAKALPPKYGGSATWELPHGKVL 284
            ::....:|.:.:.:.|.|:||:.|::|...|.::|.:: ::::|..:|..||||.|  .|.|..|
Zfish   205 LIKAPKLFPIAYNLVKHFLREETRQKIAVLGSNWKDVLKNYVDADQIPAAYGGSLT--DPDGNPL 267

  Fly   285 GEFFECYS----KDYELADS 300
            ......|.    |.|.:.||
Zfish   268 CTTMLRYGGVVPKSYYVRDS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/48 (25%)
SEC14 116..272 CDD:238099 37/172 (22%)
sec14l7XP_009303977.1 CRAL_TRIO_N 26..72 CDD:215024 12/46 (26%)
CRAL_TRIO 97..258 CDD:279044 36/166 (22%)
GOLD_2 317..395 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.