DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and sec14l8

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001093463.1 Gene:sec14l8 / 558964 ZFINID:ZDB-GENE-060526-180 Length:395 Species:Danio rerio


Alignment Length:333 Identity:62/333 - (18%)
Similarity:122/333 - (36%) Gaps:119/333 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VKE-QAIKELRELIQNEKYLNLP----LDDEYMMMFLRPTHY---YPESALKRLKNF-YHMKL-- 102
            ||: :|:.:.||.:|:.    ||    ..|.:::.:||..::   ..|:.|::...| .|||:  
Zfish    10 VKQAEALAQFREKVQDV----LPQCPSQSDHFLLRWLRARNFNLQKSEAMLRKHIEFRKHMKVDT 70

  Fly   103 ------------KY--GAAC----------------------------ENIIPSKLRNVFEANIL 125
                        ||  |..|                            :::|.||:|   :..||
Zfish    71 ITTEWQVPEVIDKYLSGGMCGHDREGSPVWYDVIGPLDPKGLMHSASKQDLIKSKVR---DCEIL 132

  Fly   126 NLLPQRDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPL 190
            .  ...|:...|                            ||..:|..:      ::.|.|||.:
Zfish   133 Q--KDCDRQSER----------------------------LGRNIESIT------MVYDCEGLGM 161

  Fly   191 SHITQFTPSFAAM--LLDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKD 253
            .|:  :.|:....  :|...::.....||.:.::....:|.:.:.:.|.|:.|..|:::...|.:
Zfish   162 KHL--YKPAIETYGEVLTMFEDNYPEGLKRLFVIKAPKLFPVAYNLVKHFLSEDTRRKVIVLGSN 224

  Fly   254 YKSLI-SHIEAKALPPKYGGSAT---------------WELPHGKVLGEFFECYSKDYELADSYG 302
            ::.:: .:|:.:.||..|||..|               .|:|....:.:..:.   |||.:.|.|
Zfish   225 WQEVLQKYIDPEELPAYYGGKLTDPDGDPKCRTRITFGSEIPKSYYVRDSIKV---DYEQSVSIG 286

  Fly   303 YTEGYKMK 310
            ....::|:
Zfish   287 RGSSHQME 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 11/52 (21%)
SEC14 116..272 CDD:238099 27/158 (17%)
sec14l8NP_001093463.1 CRAL_TRIO_N 13..59 CDD:215024 11/49 (22%)
SEC14 78..246 CDD:214706 36/208 (17%)
GOLD_2 304..382 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.