DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and Ttpa

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_056582.1 Gene:Ttpa / 50500 MGIID:1354168 Length:278 Species:Mus musculus


Alignment Length:276 Identity:79/276 - (28%)
Similarity:133/276 - (48%) Gaps:18/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EQAPEWALKKAQDELREVPGVKEQAIKELRELIQNE--KYLNLPLDDEYMMMFLRPTHYYPESAL 91
            |..|...:.|..:||.:...:.:..:.|||..:|..  .....||.|.:::.|||...:..:.|.
Mouse     3 EMRPGPLVGKQLNELPDHSPLLQPGLAELRRRVQEAGVPQTPQPLTDAFLLRFLRARDFDLDLAW 67

  Fly    92 KRLKNFYHMKLKYGAAC----ENIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQV 152
            :.:||:|    |:.|.|    .::.|..:..:.:|....:|..||..|.|:|:.... .|.|...
Mouse    68 RLMKNYY----KWRAECPELSADLRPRSILGLLKAGYHGVLRSRDSTGSRVLIYRIA-YWDPKVF 127

  Fly   153 PLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLK 217
            ...|:||...:|....:.|..:|..|...|.|:||..:||..|.|||.|..:...:.:...::::
Mouse   128 TAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSHAFQITPSVAKKIAAVLTDSFPLKVR 192

  Fly   218 AVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYK-SLISHIEAKALPPKYGGSATWELPHG 281
            .:|::|...||:.:|::.|||:.||::.||..||.:|| |::.|. ...||.:|||.   |....
Mouse   193 GIHLINEPVIFHAVFSMIKPFLTEKIKDRIHLHGNNYKSSMLQHF-PDILPREYGGK---EFSME 253

  Fly   282 KVLGEF--FECYSKDY 295
            .:..|:  |...|:||
Mouse   254 DICQEWTNFIMKSEDY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 11/46 (24%)
SEC14 116..272 CDD:238099 48/156 (31%)
TtpaNP_056582.1 CRAL_TRIO_N 25..73 CDD:215024 12/47 (26%)
CRAL_TRIO 99..248 CDD:279044 48/150 (32%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W67 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W68 208..211 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.