DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and CG11550

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster


Alignment Length:283 Identity:55/283 - (19%)
Similarity:104/283 - (36%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKKA--QDELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPE---------- 88
            :|:|  :|:....|.::...:.:..:.|..:.:::....:...:.|.....|..|          
  Fly     1 MKEANLEDQYASFPEIRRPEVLKFLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDTNL 65

  Fly    89 SALKRLKNFYHMKLKYGAACENIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQVP 153
            :|...|:.|:     ....||.   .::|.......:..||.....|.|:::.:. .....|...
  Fly    66 TARTHLEEFF-----VNLDCER---PEIRRAMRTVSIVPLPGATPEGYRVILAKL-DDLNTSNYN 121

  Fly   154 LVDLFR-------------GIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLL 205
            ..|:.:             |||         |     |.|::||::...|.|:.:.........|
  Fly   122 FADVMKLYCMVFDFWMYEDGIQ---------P-----GHVIVIDLKNTSLGHVARIGLLQMKKFL 172

  Fly   206 DYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKY 270
            .|:||...:||...|.:|.....:.:.|:..||::::|...:..| .|.|.....:..:.||.:|
  Fly   173 YYLQEAAAIRLIGFHFINIVPFMDKILALMTPFMKKELTTVLHMH-SDLKEFYKFVPQEMLPKEY 236

  Fly   271 GGSATWELPHGKVLGEFFECYSK 293
            ||    :|....|..|.:  |.|
  Fly   237 GG----QLEEANVAKEIY--YKK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 6/54 (11%)
SEC14 116..272 CDD:238099 35/168 (21%)
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 36/164 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.