DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and CG2663

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster


Alignment Length:250 Identity:72/250 - (28%)
Similarity:123/250 - (49%) Gaps:28/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 QDELREV--PGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLKNFYHMKL 102
            ::||||.  |...|:.||.:||.::.:.:|...:||..:..|||...:..|...|:|..:|.|: 
  Fly    15 REELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKLDMYYTMR- 78

  Fly   103 KYGAACENIIP----SKLRNVFEANIL------NLLPQRDQHGRRLLVLEA-GKKWKPSQVPLVD 156
                   |.:|    ::..|..|.||:      ..||....:|||:..:.. ...::|..:  :|
  Fly    79 -------NAVPEFFSNRDINREELNIVLDYVHCPTLPGITPNGRRITFIRGIDCDFQPHHI--LD 134

  Fly   157 LFRGIQLTVLGS--MVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKAV 219
            ..: :.| ::|.  :.|....|.|.:.|:|......:|..:|:|:.....|..:||...:::|.|
  Fly   135 AMK-VAL-MIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTVVKKFLIAVQEAYPVKVKEV 197

  Fly   220 HIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGSA 274
            |::|.|.:.:.:|...|||::||:|.||.|| .|.:||...:....||.:|||.|
  Fly   198 HVINISPLVDTIFNFVKPFVKEKIRSRITFH-NDVESLYKVVPRDLLPNEYGGKA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 14/44 (32%)
SEC14 116..272 CDD:238099 46/164 (28%)
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 14/45 (31%)
SEC14 95..250 CDD:238099 45/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
55.020

Return to query results.
Submit another query.