DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and rlbp1b

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_991253.1 Gene:rlbp1b / 402990 ZFINID:ZDB-GENE-040426-1870 Length:307 Species:Danio rerio


Alignment Length:291 Identity:70/291 - (24%)
Similarity:131/291 - (45%) Gaps:37/291 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSAQIRMEKEQA-----------------------PEWALKKAQDELREVPGVKEQAIKELRELI 61
            |:.::..|:|||                       |:..::||:|||.|....:..|:||||.:|
Zfish     6 GTFRMVSEEEQALRAKLEHLTVKDHGPVFEASTKVPDHTMQKAKDELNETDEKRTSAVKELRGII 70

  Fly    62 QNEKYLNLPL-----------DDEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGAACENIIPSK 115
            :.:......|           .|..::.|:|...|....|.:.:|.:...:..|....||:.|..
Zfish    71 KEKAETGDELAKGVQDTFGEKPDGVLVRFIRARKYDVNRAYELMKGYVRFRRDYPELFENLTPEA 135

  Fly   116 LRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGSMVE-PYSQICGS 179
            :|:..||....:|..||::||.:|:... :.|...::...::.|. ...:|..::| ..:||.|.
Zfish   136 VRSTIEAGYPGILSSRDKYGRVVLLFNI-ENWDYEEITFDEILRA-YCVILEKLLENEETQINGF 198

  Fly   180 VVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLR 244
            .:|.:.:|..:...:...|:....::|.:|:....|.||||.::..:.|...:.|.||.::.||.
Zfish   199 CIIENFKGFTMQQASGIKPTELKKMVDMLQDSFPARFKAVHFIHQPWYFTTTYNVVKPLMKSKLL 263

  Fly   245 KRIFFHGKDYKSLISHIEAKALPPKYGGSAT 275
            :|:|.||.|.::.....:|:.||..:.|..:
Zfish   264 ERVFVHGDDLENYFKEFDAEILPSDFDGKGS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/55 (22%)
SEC14 116..272 CDD:238099 40/156 (26%)
rlbp1bNP_991253.1 CRAL_TRIO_N 60..117 CDD:215024 13/56 (23%)
CRAL_TRIO 143..292 CDD:279044 37/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8432
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.