DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and CG32485

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster


Alignment Length:243 Identity:46/243 - (18%)
Similarity:97/243 - (39%) Gaps:48/243 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKR-LKNF------YHMKL 102
            |:..:.||..|:|:|.::             :::...|..|:.:.:|:| |:.|      :...|
  Fly     5 ELAPINEQDFKDLKERMK-------------LIVEADPKQYHNDFSLRRYLRAFKTTDDAFQAIL 56

  Fly   103 KYGAACENIIPSKLRNVFEANI---LNLLPQRDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLT 164
            |.....|.....||..:..:.:   ..||..||..||.::.:.|  |...|:..:.:|.|.|...
  Fly    57 KTNKWRETYGVDKLSEMDRSQLDKKARLLRHRDCIGRPVIYIPA--KNHSSERDIDELTRFIVYN 119

  Fly   165 VLGSMVEPYSQICGSV-VIIDMEGLPLSHITQFTPSFAAMLLDY--IQECICM-------RLKAV 219
            :..:..:.:.::...: ::.|:            ..|:...:||  :|..|.:       ||...
  Fly   120 LEEACKKCFEEVTDRLCIVFDL------------AEFSTSCMDYQLVQNLIWLLGKHFPERLGVC 172

  Fly   220 HIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALP 267
            .|:|:..:|:.::...:..:.:...|::.|.. |...|..::....||
  Fly   173 LIINSPGLFSTIWPAIRVLLDDNTAKKVKFVA-DEAELCQYLIPDILP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 10/45 (22%)
SEC14 116..272 CDD:238099 30/165 (18%)
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 26/148 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.