DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and Sec14l3

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:250 Identity:54/250 - (21%)
Similarity:104/250 - (41%) Gaps:42/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QAIKELRELIQNEKYLNLPL----DDEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGAACENII 112
            :.:.:.||.:|:.    ||.    ||.:::.:||..::..:.:...|:.:  |:.:.....::|:
Mouse    14 ETLAKFRENVQDV----LPALPNPDDYFLLRWLRARNFDLQKSEAMLRKY--MEFRKTMDIDHIL 72

  Fly   113 PSKLRNVFEANILNLLPQRDQHGRRL---LVLEAGKKWKPSQVPLVDLFR-------------GI 161
            ..:...|.:..:...|...|:.|..:   ::.....|.....|...||.:             .:
Mouse    73 DWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKTKMRDCERILHECDL 137

  Fly   162 QLTVLGSMVEPYSQICGSVVIIDMEGLPLSH----ITQFTPSFAAMLLDYIQECICMRLKAVHIV 222
            |...||..:|..      |:|.|.|||.|.|    :.:....|..:|.:...|    .||.:.||
Mouse   138 QTERLGRKIETI------VMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPE----TLKFMLIV 192

  Fly   223 NNSYIFNMLFAVFKPFIREKLRKRIFFHGKD--YKSLISHIEAKALPPKYGGSAT 275
            ..:.:|.:.:.:.|||:.|..|::|...|.:  .:.|:..|..:.||..:||:.|
Mouse   193 KATKLFPVGYNLMKPFLSEDTRRKIVVLGSNSWKEGLLKLISPEELPAHFGGTLT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 10/47 (21%)
SEC14 116..272 CDD:238099 39/177 (22%)
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 10/48 (21%)
SEC14 76..246 CDD:214706 41/179 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.