DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and Clvs1

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001102439.1 Gene:Clvs1 / 366311 RGDID:1564200 Length:354 Species:Rattus norvegicus


Alignment Length:282 Identity:81/282 - (28%)
Similarity:136/282 - (48%) Gaps:28/282 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKKAQDELREVPGVKEQAIKELRELIQNEKYLN-LPLDDEYMMMFLRPTHYYPESALKRLKNFYH 99
            ::||:.||.|.|.|..|.|:::|::|.....:. |..||.:::.|||...::...|.:.|..::.
  Rat    35 IEKARLELNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQ 99

  Fly   100 MK------LKYGAACENIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQVPLVDLF 158
            .:      .|...|.:..|...|.:.|.    .:|..||.:||::|:|.|. .|..|:....|:.
  Rat   100 YRQLNLDMFKNFKADDPGIKRALIDGFP----GVLENRDHYGRKILLLFAA-NWDQSRNSFTDIL 159

  Fly   159 RGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKAVHIVN 223
            |.|.|::...:.:|..||.|.::|||.........::.|||...:.::.:|:....|...||.||
  Rat   160 RAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHFVN 224

  Fly   224 NSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGS------ATWELPHGK 282
            ..:..:.|:.:.|||:::|.|||||.||.:..||...|..:.||.::||:      .||.   ..
  Rat   225 QPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMGTWA---RT 286

  Fly   283 VLGEFFECYSKDYELADSYGYT 304
            :||       .||...:.|.:|
  Rat   287 LLG-------PDYSDENDYTHT 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/45 (27%)
SEC14 116..272 CDD:238099 49/155 (32%)
Clvs1NP_001102439.1 CRAL_TRIO_N 51..97 CDD:215024 12/45 (27%)
CRAL_TRIO 125..274 CDD:395525 49/153 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59833
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.