DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and CG1902

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster


Alignment Length:271 Identity:72/271 - (26%)
Similarity:113/271 - (41%) Gaps:45/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQIR-MEKEQAPEWALKKAQDELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHY 85
            |:|| :|.|.|     :.|:.:|.|.|......|:.||..|..:.||....||::::.|||...:
  Fly     2 AKIRSLEPELA-----EVARTQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRW 61

  Fly    86 YPESALKRLKNFYHMKLKYGAACE-NIIPSKLRNVFEANILNLLPQR-DQHGRRLLVLEAGKKWK 148
            ..|.|.||:..:|..|.|.....: ..:..||..:..:.|...||:. ...|.|:.....| ..:
  Fly    62 DVEEAKKRVLFYYTYKSKERELLKGRQVDDKLIELARSGIFATLPKPIGPGGPRIHYTRMG-HIE 125

  Fly   149 PSQVPLVDLFR------GIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDY 207
            ||:..:.|:||      .|::.     .:....|.|.|.|||...:|.|.:.||.|.....:..:
  Fly   126 PSKHSVSDIFRFHAFRAEIEIN-----TDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAF 185

  Fly   208 IQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREK-----------LRKRIFFHGKDYKSLISHI 261
            ::..|...|.|.||||.|.....:..:.:..:::|           |||.|   |.:|       
  Fly   186 LEHGIPANLVATHIVNASRETQFVLGLVRNVMKQKELLHIHSTVASLRKAI---GLEY------- 240

  Fly   262 EAKALPPKYGG 272
                ||.:.||
  Fly   241 ----LPVEMGG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 15/44 (34%)
SEC14 116..272 CDD:238099 41/173 (24%)
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 13/40 (33%)
CRAL_TRIO 100..248 CDD:279044 42/168 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.