DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and C11H1.9

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001024391.1 Gene:C11H1.9 / 3564775 WormBaseID:WBGene00023500 Length:421 Species:Caenorhabditis elegans


Alignment Length:280 Identity:58/280 - (20%)
Similarity:101/280 - (36%) Gaps:74/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EQAIKELRELIQNEKYLNLPLD-DEY-MMMFLRPTHYYPESALKRLKNFYHMKLKYGAACENI-- 111
            :|.:.::|..|....:.|...| :.| .:|....||......:|......:..|:|..|. |:  
 Worm    16 KQMVNDVRLKIGQPIHPNFNTDFNVYRFIMAAERTHKKERDVIKHAALALNNHLRYRKAL-NLDV 79

  Fly   112 --IPSKLRN-VFEANIL---NLLPQRDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGSMV 170
              |||...| :|:..::   .:|.:.|...|.|..:|               :..|.:..:...:
 Worm    80 EHIPSFDGNPIFQKRLMPRGEILEKTDNQNRLLWYIE---------------YATITVESIAHSI 129

  Fly   171 EPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQE-----CI-CMRLKAVHIVN-NSYIF 228
            .. |:.|.               .||. .|..||...:::     |: .:|    |||| :.|..
 Worm   130 RS-SEACK---------------FQFL-QFEYMLRKVMEQEERTGCLSSLR----HIVNMDGYEI 173

  Fly   229 NMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIE--------------AKALPPKYGGSATWELP 279
            |....||..........:: ||.::|..|::.::              |||:.|. |.|..:.| 
 Worm   174 NPFTMVFVTSGTLAYYSQL-FHFENYPELVTPVDMVNIAKWIHVPYKIAKAMMPT-GFSEKFRL- 235

  Fly   280 HGKVLGEFFECYSKDYELAD 299
            |.:   .|.|..::|..:.|
 Worm   236 HDR---HFIETLTEDINIDD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 10/46 (22%)
SEC14 116..272 CDD:238099 33/180 (18%)
C11H1.9NP_001024391.1 SEC14 88..261 CDD:214706 41/207 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.