DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and CG10026

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:303 Identity:99/303 - (32%)
Similarity:160/303 - (52%) Gaps:39/303 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EHKLPYIDLGSAQIRMEKEQAPEWALKKAQDELREVPGVKEQAIKELRE-LIQNEKYLNLPLDDE 74
            ||||          .:.:|:.||...:.||:: .|.|..|::.|::.|. ::::.:......|.:
  Fly    14 EHKL----------NITEEEVPEHIRRLAQEQ-GECPSSKDKVIEQFRNYILEHNECQPHRSDAK 67

  Fly    75 YMMMFLRPTHYYPESALKRLKNFYHMKLKYGAACENIIPSKLRNVFEANILNLLPQRDQHGRRLL 139
            |:..|||..::..|::.|.|.::|..:.:..:..|.:.|..||:|.:::||.:.|.|||||.|:|
  Fly    68 YLEKFLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPLDLRHVGQSDILTVTPYRDQHGHRIL 132

  Fly   140 VLEAGKKWKPSQVPLVDLFRG-IQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAM 203
            :...| .|:|:||.:.|:||. |.|..|||: ||.|||.|.|.|.|::.|.|.||...:||.|..
  Fly   133 IYRFG-LWRPNQVTVDDIFRATIVLQELGSL-EPISQIVGGVGIFDLKDLGLEHILHLSPSVAQK 195

  Fly   204 LLDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPP 268
            ::..:...:.:|..|:||||.:::||..|.:||||:...:|::::.||.|..||..||..:.||.
  Fly   196 MIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMTSLHKHINPEHLPK 260

  Fly   269 KYGGSATWELPHGKVLGEFFECYSKDYELADSYGYTEGYKMKK 311
            :|||                        |.:.|.||....|.|
  Fly   261 RYGG------------------------LHEDYSYTLWLDMLK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 10/45 (22%)
SEC14 116..272 CDD:238099 66/156 (42%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 10/46 (22%)
SEC14 112..265 CDD:238099 66/178 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118099at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8539
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
76.920

Return to query results.
Submit another query.