DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and CG10237

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:308 Identity:128/308 - (41%)
Similarity:188/308 - (61%) Gaps:27/308 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DEHKLPYIDLGSAQIRME----KEQAPEWALKKAQDELREVPGVKEQAIKELRELIQNEKYLNLP 70
            |..:||.:.:|...::.|    ..|..|.|:|    ||||.|..:::|.|||..|::.|..|..|
  Fly    27 DIDQLPTLQVGDYTLQFELGEPTAQGKEVAIK----ELRETPERQKEASKELARLLEAETDLLYP 87

  Fly    71 L-DDEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGAACENIIPSKLRNVFEANILNLLPQRDQH 134
            . ::|:::.:|||..||||||...:|.:|..|:|:.....::.||...|:|:.|||.:.|.|||.
  Fly    88 KGNEEWLIRYLRPCKYYPESARDLIKRYYAFKVKHADVYTDLKPSNEANIFKHNILTVFPNRDQL 152

  Fly   135 GRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPS 199
            |||:||||.||:||..||.|.::|:|..|.:..:|:||.:||||:|||.||:||.|....||||.
  Fly   153 GRRILVLELGKRWKHKQVTLDEVFKGAVLFLEAAMLEPETQICGAVVIFDMDGLSLQQTWQFTPP 217

  Fly   200 FAAMLLDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAK 264
            ||..::|::|:.:.:|:||:||||...||.::||:||||::||||.||.|||.|.:||..::..|
  Fly   218 FAKRIVDWLQDSVPLRIKAIHIVNQPKIFQVVFALFKPFLKEKLRSRIIFHGTDRESLHKYMSPK 282

  Fly   265 ALPPKYGG--------SATW-ELPHGKVLGEFFECYSKDYELADSYGY 303
            .||..|||        |..| :|        ..:| ..:::..:||||
  Fly   283 CLPAAYGGFREASRIDSDQWYQL--------LLKC-DTEFDTINSYGY 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 18/45 (40%)
SEC14 116..272 CDD:238099 80/155 (52%)
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 19/46 (41%)
SEC14 137..290 CDD:238099 79/152 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4154
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59833
OrthoDB 1 1.010 - - D118099at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8432
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
98.980

Return to query results.
Submit another query.