DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and Ku80

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:220 Identity:43/220 - (19%)
Similarity:87/220 - (39%) Gaps:58/220 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KAECISYDEHKLPYID--LGSAQIR---MEKEQAPEWALKKAQDEL---REVPGVKEQAIKELRE 59
            |.||   .|.:|..||  :.|..:.   .:.:|...|    ||::|   ..:|.:.||.:.::.|
  Fly   416 KTEC---SEEQLNAIDQLIDSTDLECTLRDTQQPRPW----AQNDLLPFDALPSIFEQNVMDILE 473

  Fly    60 ---LIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGAACENIIPSKLRNVFE 121
               :..|:|...:..|..:..:|.|    .|:...::.|       :..|..:.:.|.:....::
  Fly   474 RKVIYDNDKEDKMLKDKNFADVFWR----VPDPLEEKSK-------RAAAIVKKLFPLRYSRAWQ 527

  Fly   122 ANILNLLPQRDQHGRRLLVLEAGKKWKPS--QVPLVDLFRGIQLTVLGSMVEPYS---QICGSVV 181
            ..:  |..::.::|       ...|.:|:  ::||..  .|:      .:::|.|   ::..||.
  Fly   528 EKL--LAKEQAENG-------VAVKSEPAEKEIPLPS--DGV------GLIDPISDFRRVLASVH 575

  Fly   182 IIDMEGLPLSHITQFTPSFAAMLLD 206
            .|       |:.|:....|.|:..|
  Fly   576 TI-------SNATERDARFQALAAD 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 9/47 (19%)
SEC14 116..272 CDD:238099 17/96 (18%)
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 26/125 (21%)
Ku_PK_bind 562..663 CDD:285938 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.