DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and retm

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster


Alignment Length:321 Identity:59/321 - (18%)
Similarity:120/321 - (37%) Gaps:92/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IDLGSAQIR------MEKEQAPEWALK-----KAQDE--------------LREVPGVKEQAIKE 56
            |:....|:|      :|:..:|..|.|     :|.|:              |.::..::|..:.|
  Fly   163 IEFFIGQLREEGITHVERWTSPSDATKSPTLDQASDQQHSILLDGDFIARSLGQLSPMQESKLLE 227

  Fly    57 LRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLKNF-----------YHMKLKYGAACEN 110
            ||:::..       :||                 |:|:.::           :|:...|...|::
  Fly   228 LRKMLDG-------VDD-----------------LERVPSYQTILRFLAARDWHVSQAYAMLCDS 268

  Fly   111 I-------IPSKLRNVFE-ANILNLLP----QRDQHGRRLLVLEAGK---KWKPSQVPLVDLFR- 159
            :       |.:.|....: |.::...|    ..|:.||.:.:|..|.   |.....:.:..|.| 
  Fly   269 LRWRREHRIDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRL 333

  Fly   160 -------GIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAML--LDYIQECICMR 215
                   ||| .:..|.......:....:::|:|||.:.|:  :.|...|:|  ::.::......
  Fly   334 ALHICEEGIQ-KINESAERLEKPVLNWSLLVDLEGLSMRHL--WRPGIKALLNIIETVERNYPET 395

  Fly   216 LKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKD----YKSLISHIEAKALPPKYGG 272
            :..|.:|....:|.:.:.:...||.|..|.:..|:|.|    ...|..:::.:.:|...||
  Fly   396 MGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGG 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 8/44 (18%)
SEC14 116..272 CDD:238099 35/177 (20%)
retmNP_001260132.1 PRELI 17..173 CDD:282550 3/9 (33%)
CRAL_TRIO_N 222..268 CDD:215024 11/69 (16%)
CRAL_TRIO 293..456 CDD:279044 33/165 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.