DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and CG31826

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:286 Identity:66/286 - (23%)
Similarity:119/286 - (41%) Gaps:74/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLKNFYHMK----------------- 101
            |::||:|::..:.|.:..:|..:..||..|.:....|.:.:.::|..|                 
  Fly    18 IEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHPTWVARHPIEHYRQ 82

  Fly   102 LKYGAACENIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVL 166
            |.||..|..:                :||.|:.||.|:|.:.           ||.|:... ..|
  Fly    83 LFYGTHCRYV----------------MPQADRSGRVLVVFKT-----------VDGFQDYP-DYL 119

  Fly   167 GSMVE------------PYSQICGSVVIIDMEGLPLSHITQFTPSFAAM------LLDYIQECIC 213
            .|:||            |..|..|..||.|::|...:.:.||:|:|..:      :|.:.|    
  Fly   120 QSLVEMDDLIFESLLLLPRVQQNGITVICDLQGTNRNFLRQFSPAFMKVVNEKNGVLPFSQ---- 180

  Fly   214 MRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFH-GKDYKSLISHIEAKALPPKYGGSATWE 277
               :.|||:...::.::...:|.||:.::.:::||.| |:....|...:..::||.:|||.||..
  Fly   181 ---RIVHIIQRGFLMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATNV 242

  Fly   278 LPHGKVLGEFFECYSKDY-ELADSYG 302
            |....:.....:  :.:| |...:||
  Fly   243 LDTNLIFNHLSQ--NAEYLEKLQTYG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 10/41 (24%)
SEC14 116..272 CDD:238099 41/174 (24%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 10/42 (24%)
CRAL_TRIO 92..237 CDD:279044 41/179 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.