DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and ttpa

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_956025.2 Gene:ttpa / 325906 ZFINID:ZDB-GENE-030131-4631 Length:285 Species:Danio rerio


Alignment Length:265 Identity:73/265 - (27%)
Similarity:125/265 - (47%) Gaps:36/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MEKEQAPEWALKKAQDELREVP-----------GVKEQAIKELRELIQNEKYLNLPLDDEYMMMF 79
            |:.|:..|      .:||..:|           .:||:|..|||       ..:|.|...:::.|
Zfish     1 MKSEEVDE------TEELNNLPVDSSRIAPYLSELKEKAEAELR-------IRDLDLSKTFLIRF 52

  Fly    80 LRPTHYYPESALKRLKNFYHMKLKYGAACENII----PSKLRNVFEANILNLLPQRDQHGRRLLV 140
            |:...:....|||.|.| ||   |:...|..|.    ||.:..:.:.|...:|..||..|.|:|:
Zfish    53 LQARDFDVALALKLLIN-YH---KWRQECPEITADLRPSSVIGLLQNNYHGVLRSRDDAGSRVLI 113

  Fly   141 LEAGKKWKPSQVPLVDLFRGIQLTVLGSMVEPY-SQICGSVVIIDMEGLPLSHITQFTPSFAAML 204
            ...| ||.|.:....::|| :.|.....:|:.: :|..|...|.|::....:|..|..||.|..:
Zfish   114 YRIG-KWNPKEFTAYEVFR-VSLITSELIVQEWETQRNGLKAIFDLQDWCFAHALQINPSLAKKI 176

  Fly   205 LDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDY-KSLISHIEAKALPP 268
            ...:.:...::::.:|::|....|..:||:.:||:.:|:::||..||..| :||.::.....|||
Zfish   177 SSVLTDSFPLKVRGIHLINEPIFFRPVFAMIRPFLPDKIKQRIHMHGCSYARSLCNYFPKAVLPP 241

  Fly   269 KYGGS 273
            .|||:
Zfish   242 VYGGT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 13/44 (30%)
SEC14 116..272 CDD:238099 43/157 (27%)
ttpaNP_956025.2 CRAL_TRIO_N 26..70 CDD:215024 15/51 (29%)
CRAL_TRIO 97..246 CDD:279044 43/150 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.