DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and CG3823

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:298 Identity:71/298 - (23%)
Similarity:127/298 - (42%) Gaps:55/298 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KKAQDELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLKNFYHMK 101
            :||:|:|...      .|.:|::.:|.:..|...:....:..||..|. ...||.:||     ::
  Fly     6 EKAEDQLMTT------RISDLQDWLQAQPQLPQNISRLLLRRFLHTTR-GDLSAAQRL-----LE 58

  Fly   102 LKYGAACENIIPSKLRNVF------EANILNLLPQRD---------QHGR----RLLVLEAGKKW 147
            |.||      :.:|..::|      :|:...||...|         ::.:    ||:..:|.|..
  Fly    59 LNYG------LRNKHAHIFIDRDPLDASSQQLLQVADLVPLPGLTPENNKLLFYRLIDFDADKFN 117

  Fly   148 KPSQVPLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECI 212
            ..:.:.:..:....:......  |..|.  |.:.:.||.|..|.|:|:.......:.:.::||..
  Fly   118 FTAAIKVFFMVADCRFATENE--ERLSD--GEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAH 178

  Fly   213 CMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGSA--- 274
            .:|||.:|::|.....:.:.||.||||:.::.|.|.||..:..:...|.....||.:|||.|   
  Fly   179 PVRLKEIHVLNCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKM 243

  Fly   275 -TWELPHGKVLGEFFECYSKDYELADSYGYTEGYKMKK 311
             ..:|...::|.|     .:|| |.|    ||.:::.|
  Fly   244 SDLKLQWMQLLKE-----QRDY-LMD----TENWQINK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 11/44 (25%)
SEC14 116..272 CDD:238099 39/174 (22%)
CG3823NP_572313.1 SEC14 90..239 CDD:238099 35/152 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.