DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and CG3191

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster


Alignment Length:270 Identity:64/270 - (23%)
Similarity:111/270 - (41%) Gaps:53/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKKAQDELREVPGVKEQAIKELRELI----QNEKYLNLPLDDE-------YMMMF---------- 79
            |::.||.......|::|. ::|:||:    ||:|   ||.:.:       |..||          
  Fly    18 LQREQDSDTSEQAVRKQE-RDLKELLEWFRQNDK---LPKEIDPLLLRRFYQCMFGDVEETRKLI 78

  Fly    80 -----LRPTHYYPESALKRLKNFYHMKLKYGAACENIIPSKLRNVFE-ANIL---NLLPQRDQHG 135
                 ||..|  |...:||                :.:.:..:..|: |:||   .|.|.:.:..
  Fly    79 EVNYALRNRH--PHLFIKR----------------DPLDADSKRTFDYADILPLPGLTPDKCKVS 125

  Fly   136 RRLL-VLEAGKKWKPSQVPLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPS 199
            .... ..||.|...........:....:......:.:|.....|.|.|.||:|..:.||::.|.|
  Fly   126 LYCFREFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTIS 190

  Fly   200 FAAMLLDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAK 264
            .....:.::|....:||:|:|::|.....:.:.:|.||||.:::.|.|.||.:...:|...:..:
  Fly   191 TLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPRE 255

  Fly   265 ALPPKYGGSA 274
            .||.:|||.|
  Fly   256 MLPEEYGGGA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 18/70 (26%)
SEC14 116..272 CDD:238099 39/160 (24%)
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 35/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.