DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and Ttpal

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001100007.1 Gene:Ttpal / 296349 RGDID:1305754 Length:343 Species:Rattus norvegicus


Alignment Length:238 Identity:81/238 - (34%)
Similarity:137/238 - (57%) Gaps:2/238 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KAQDELREVPGVKEQAIKELRELIQNE-KYLNLPLDDEYMMMFLRPTHYYPESALKRLKNFYHMK 101
            ||::||:|.|..:.:.::.||::::.| .||:..|||.:::.|||...:..:.||:.|.|::..:
  Rat    43 KAREELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCR 107

  Fly   102 LKYGAACENIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVL 166
            ..:.....|:.||.|::|..:..|.:||..|..|..:|.:.. .:|.||..|:.:..|.|.||:.
  Rat   108 RSWPEVFSNLRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRP-DRWIPSNYPITENIRAIYLTLE 171

  Fly   167 GSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKAVHIVNNSYIFNML 231
            ..:....:|:.|.|::.|.:|:.||..:.|.|..|..::..:|:...:|:|||||||...||..:
  Rat   172 KLIQSEETQVNGVVILADYKGVSLSKASHFGPFIARKVIGILQDGFPIRIKAVHIVNEPRIFKGI 236

  Fly   232 FAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGSA 274
            ||:.|||::||:..|.|.||.|..||.:.:....||.:|||:|
  Rat   237 FAIIKPFLKEKIANRFFLHGSDLSSLHTSLPRNILPKEYGGTA 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 14/45 (31%)
SEC14 116..272 CDD:238099 54/155 (35%)
TtpalNP_001100007.1 CRAL_TRIO_N 57..103 CDD:215024 14/45 (31%)
SEC14 122..278 CDD:238099 55/156 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5546
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4146
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9153
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.