DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and Rlbp1

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001099744.1 Gene:Rlbp1 / 293049 RGDID:1309649 Length:317 Species:Rattus norvegicus


Alignment Length:270 Identity:70/270 - (25%)
Similarity:129/270 - (47%) Gaps:18/270 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QAPEWALKKAQDELREVPGVKEQAIKELRELIQNEKYLNLPL-----------DDEYMMMFLRPT 83
            |.|...|:||:|||.|....:::|::||:||:|.:......|           |..:::.|:|..
  Rat    39 QLPRHTLQKAKDELNEREETRDEAVRELQELVQAQAASGEELAVAVAERVQARDSAFLLRFIRAR 103

  Fly    84 HYYPESALKRLKNFYHMKLKYGAACENIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWK 148
            .:....|.:.||.:.:.:|:|....:::....||...||....:|..||::||.:::... :.|.
  Rat   104 KFDVGRAYELLKGYVNFRLQYPELFDSLSMEALRCTIEAGYPGVLSSRDKYGRVVMLFNI-ENWH 167

  Fly   149 PSQVPLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECIC 213
            ..:|...::.:.....:...:....:||.|..::.:.:|..:.......||....::|.:|:...
  Rat   168 CEEVTFDEILQAYCFILEKLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLKKMVDMLQDSFP 232

  Fly   214 MRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGSATWEL 278
            .|.||:|.::..:.|...:.|.|||::.||.:|:|.||.|.......|:...||..:||:    |
  Rat   233 ARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENILPADFGGT----L 293

  Fly   279 P--HGKVLGE 286
            |  .|||:.|
  Rat   294 PKYDGKVVAE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/55 (22%)
SEC14 116..272 CDD:238099 38/155 (25%)
Rlbp1NP_001099744.1 CRAL_TRIO_N 60..117 CDD:215024 13/56 (23%)
CRAL_TRIO 143..292 CDD:279044 35/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.