DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and Sec14l5

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001129182.2 Gene:Sec14l5 / 287060 RGDID:1564638 Length:696 Species:Rattus norvegicus


Alignment Length:301 Identity:59/301 - (19%)
Similarity:115/301 - (38%) Gaps:88/301 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGAACENIIP 113
            ::|..:.:||..:|......:| .||:::.|||...::.:.|...|             |::   
  Rat   241 MQESCLVQLRRWLQETHKGKIP-KDEHILRFLRARDFHLDKARDML-------------CQS--- 288

  Fly   114 SKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQVPLVDLFRG-----------IQLTVLG 167
                          |..|.||...||:    :.|:| ..||.:.:.|           :.:..||
  Rat   289 --------------LSWRKQHQVDLLL----QTWRP-PAPLQEFYAGGWHYQDIDGRPLYILRLG 334

  Fly   168 SM--------------------VEPYSQ-------------ICGSVVIIDMEGLPLSHITQFTPS 199
            .|                    |....|             |.....::|:|||.:.|:  :.|.
  Rat   335 QMDTKGLMKAVGEEALLQHVLSVNEEGQKRCEGNTRQFGRPISSWTCLLDLEGLNMRHL--WRPG 397

  Fly   200 FAAML--LDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKR-IFFHGKDYK---SLI 258
            ..|:|  ::.:::.....|..:.||....:|.:|:.:..|||.|..|:: :.:.|.:|:   .|:
  Rat   398 VKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLVSPFINENTRRKFLIYSGSNYQGPGGLV 462

  Fly   259 SHIEAKALPPKYGGSATWELPHGKVLGEFFECYSKDYELAD 299
            .:::...:|...||.:...:|.|.::.:......::.|.||
  Rat   463 DYLDKDVIPDFLGGESVCNVPEGGMVPKSLYLTEEEQEQAD 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/44 (27%)
SEC14 116..272 CDD:238099 39/205 (19%)
Sec14l5NP_001129182.2 PRELI 17..173 CDD:309720
Amidase <179..309 CDD:327489 21/103 (20%)
CRAL_TRIO_N 243..288 CDD:215024 13/58 (22%)
CRAL_TRIO 314..477 CDD:306996 30/164 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.