DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and SEC14L4

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_016884276.1 Gene:SEC14L4 / 284904 HGNCID:20627 Length:465 Species:Homo sapiens


Alignment Length:332 Identity:71/332 - (21%)
Similarity:140/332 - (42%) Gaps:90/332 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LGSAQIRMEKEQAPEWALKKAQDELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPT 83
            ||:..:..|..:||. .::.:..:.||       .:::|..::.|       .||.:::.:||..
Human    55 LGAGLVAPEVMRAPP-TIRSSSAQFRE-------NLQDLLPILPN-------ADDYFLLRWLRAR 104

  Fly    84 HY---YPESALKRLKNFYHMKLKYGAACENII---PSKLRNVFEANIL------------NLLPQ 130
            ::   ..|..|:|     ||:.:.....:||:   |.::..::::..|            |::..
Human   105 NFDLQKSEDMLRR-----HMEFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGS 164

  Fly   131 RDQHGRRLLVLEAGKKWKPSQVPLVDLFR-------------GIQLTVLGSMVEPYSQICGSVVI 182
            .|..|   |:|.|.|:         |:.|             .:|...||..:|.      ::::
Human   165 LDPKG---LLLSASKQ---------DMIRKRIKVCELLLHECELQTQKLGRKIEM------ALMV 211

  Fly   183 IDMEGLPLSHITQ-----FTPSFAAMLLDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREK 242
            .|||||.|.|:.:     :...|:.:..:|.:     .||.:.::....:|.:.|.:.|.|:.|:
Human   212 FDMEGLSLKHLWKPAVEVYQQFFSILEANYPE-----TLKNLIVIRAPKLFPVAFNLVKSFMSEE 271

  Fly   243 LRKRIFFHGKDYK-SLISHIEAKALPPKYGGSATWELPHGKVLGEFFECYSK-DY--ELADSYGY 303
            .|::|...|.::| .|...|....||.::||:.|  .|.|..     :|.:| :|  |:..||..
Human   272 TRRKIVILGDNWKQELTKFISPDQLPVEFGGTMT--DPDGNP-----KCLTKINYGGEVPKSYYL 329

  Fly   304 TEGYKMK 310
            .|..:::
Human   330 CEQVRLQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 9/47 (19%)
SEC14 116..272 CDD:238099 38/186 (20%)
SEC14L4XP_016884276.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.