DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and SEC14L2

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_036561.1 Gene:SEC14L2 / 23541 HGNCID:10699 Length:403 Species:Homo sapiens


Alignment Length:284 Identity:68/284 - (23%)
Similarity:116/284 - (40%) Gaps:78/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KEQAIKELRELIQNEKYLNLPL----DDEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGAACEN 110
            :::|:.:.||.:|:.    ||.    ||.:::.:||...:..:.:...|:.  |::.:.....:|
Human    12 QKEALAKFRENVQDV----LPALPNPDDYFLLRWLRARSFDLQKSEAMLRK--HVEFRKQKDIDN 70

  Fly   111 II----PSKLRNVFEANI-----------LNLLPQRDQHGRRLLVLEAGKKWKPSQVPLVDLFR- 159
            ||    |..::......:           .:::...|..|   |:..|.|:         ||.| 
Human    71 IISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKG---LLFSASKQ---------DLLRT 123

  Fly   160 ------------GIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECI 212
                        ..|.|.||..||..:      :|.|.|||.|.|:  :.|:..|     ..|.:
Human   124 KMRECELLLQECAHQTTKLGRKVETIT------IIYDCEGLGLKHL--WKPAVEA-----YGEFL 175

  Fly   213 CM-------RLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKS-LISHIEAKALPPK 269
            ||       .||.:.:|....:|.:.:.:.|||:.|..||:|...|.::|. |:.||....:|.:
Human   176 CMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVE 240

  Fly   270 YGGSATWELPHGKVLGEFFECYSK 293
            |||:.|  .|.|..     :|.||
Human   241 YGGTMT--DPDGNP-----KCKSK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 11/48 (23%)
SEC14 116..272 CDD:238099 44/187 (24%)
SEC14L2NP_036561.1 CRAL_TRIO_N 13..59 CDD:215024 11/51 (22%)
SEC14 76..244 CDD:214706 46/192 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.