DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and R03A10.5

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_510554.2 Gene:R03A10.5 / 181634 WormBaseID:WBGene00010985 Length:382 Species:Caenorhabditis elegans


Alignment Length:321 Identity:65/321 - (20%)
Similarity:109/321 - (33%) Gaps:111/321 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VKE--------QAIKELRELIQNE--KYLN--------------LPLDD-EYMMMF---LRPTHY 85
            |||        :.|::||||::::  :|.|              ||::: ...|.|   ||....
 Worm     3 VKENDIQPYDLKKIQQLRELVKDDISEYYNTDFNILRWLQGHNTLPIEEIARKMKFHLNLRAAWN 67

  Fly    86 YPESALKRLKNFYHMKLKYGAA-----CENIIPS----------------KLRNVFEANILNLLP 129
            ..|...|...:..|...|||..     .:|:|.:                .:..|..|.:::|  
 Worm    68 LDELHKKERNHPIHKHWKYGITGPSGHMDNVIVNIEQCGKTDYTGMMETYSILEVMRARMVDL-- 130

  Fly   130 QRDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHIT 194
              :|....::.||| |..|.:.:..|....|:|..     .:.|..:.||:              
 Worm   131 --EQMLHHVMELEA-KTGKQAWILYVMDITGLQYN-----KKLYDLVTGSM-------------- 173

  Fly   195 QFTPSFAAMLLDYIQECI------CMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKD 253
               .|.|..:.|:..|.|      |:...|          ..|:.|.:|.:.||.|:::...|:.
 Worm   174 ---KSLADFMADHYVEMIKYFVPVCVPSFA----------TALYVVVRPLLPEKTREKVRLIGET 225

  Fly   254 --YKSLISHIEAKALPPKYGGSATWELPHGKVLGEFFECYSKDYELADSYGY-TEGYKMKK 311
              ...::.:....:||      :.|. ......|.|.|.         ..|| |:||...|
 Worm   226 NWRDDVLQYAIHSSLP------SIWN-NENHTFGGFIEL---------PIGYPTDGYYSAK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 16/72 (22%)
SEC14 116..272 CDD:238099 31/163 (19%)
R03A10.5NP_510554.2 SEC14 77..249 CDD:214706 38/215 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.