DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and cgr-1

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:137 Identity:30/137 - (21%)
Similarity:68/137 - (49%) Gaps:15/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 GSVVIIDMEGLPLSHITQFTPSFAA--MLLDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIR 240
            |.::|:|::|..:..:  :||:...  .||..:|.......:.::|:|...:.:.::|:..|.:.
 Worm   162 GVIIIMDLDGFSMDLL--YTPTLKVYMSLLTMLQNIFPDFARRIYIINCPAMMSAVYAMVSPVLS 224

  Fly   241 EKLRKRIFFHGKDYKS-LISHIEAKALPPKYGGSATWELPHGKV-LGEFFECYSKDYELADSYGY 303
            .:.|:::.|..||:|: ||..|..:.:...:||....|.|.|.: :|.         ::.:|..|
 Worm   225 SQTREKVRFLDKDWKNHLIEEIGEENIFMHWGGVKKHEHPCGDIRMGG---------KVPESLWY 280

  Fly   304 TEGYKMK 310
            .:.:|::
 Worm   281 ADSHKLE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024
SEC14 116..272 CDD:238099 21/96 (22%)
cgr-1NP_508618.2 SEC14 91..257 CDD:214706 21/96 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.