DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and F20G2.3

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_506408.1 Gene:F20G2.3 / 179870 WormBaseID:WBGene00008987 Length:377 Species:Caenorhabditis elegans


Alignment Length:254 Identity:49/254 - (19%)
Similarity:93/254 - (36%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALK-RLKNF------------------- 97
            ||.||||.:  :::|....|.::.::.....|.|....:| :|.|.                   
 Worm    10 AINELREAV--KEHLTPYYDTDFNLLRWLKGHDYKMDVIKPKLINHLLFRKSDWDLDSLADKPRD 72

  Fly    98 --YHMKLKYGAACEN-IIPSKLRNVFEA------NILNLLPQRDQHGRRLLVLEAGKKWKPSQVP 153
              .|...|.|...|: |||:.:.|:.:.      .:|:..|..:....|:..||:          
 Worm    73 HPVHHHWKTGLTGESGIIPNTIVNIEQTGSNDYWGMLHSYPTNEILRARVHDLES---------- 127

  Fly   154 LVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSH--ITQFTPSFAA----MLLDYIQECI 212
                    .|..:..:.:..:|.|..:.|:|:.|:....  ||..|...:|    |...|::   
 Worm   128 --------MLKAVMDLEKKTNQQCSVIYIMDLTGIKFDKRTITLLTGGLSAISAFMAEHYVE--- 181

  Fly   213 CMRLKAVH---IVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYK-SLISHIEAKALP 267
                 .||   :||.....:.::.:.||.:.|:.|.:......::: .::...|...||
 Worm   182 -----LVHSFVLVNVPAFISAIWTIAKPLLPERTRNKCNILNSEWRVEVLKMAEGSCLP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/43 (28%)
SEC14 116..272 CDD:238099 29/168 (17%)
F20G2.3NP_506408.1 SEC14 72..243 CDD:214706 36/190 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.