DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and T23G5.2

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001040875.1 Gene:T23G5.2 / 176302 WormBaseID:WBGene00011962 Length:719 Species:Caenorhabditis elegans


Alignment Length:283 Identity:63/283 - (22%)
Similarity:110/283 - (38%) Gaps:92/283 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGAA 107
            |.::..::|..:.|::..:|......|| :|.:::.|||...:    .:.:.|:..|        
 Worm   248 LGQLSPLEESRLCEIKYSLQAHHKGKLP-NDAHLLRFLRARDF----DVAKAKDMVH-------- 299

  Fly   108 CENIIPSKLRNVFE--------ANILNLLP----QRDQHGRRLLVLEAGKKWKPSQVPLVDLFRG 160
             .:||..|..||.:        ..|....|    ..|:.||.:.:|..|      |:....:.|.
 Worm   300 -ASIIWRKQHNVDKILEEWTRPTVIKQYFPGCWHNSDKAGRPMYILRFG------QLDTKGMLRS 357

  Fly   161 ------IQLTV----------------LGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAM 203
                  ::||:                ||:.:..:|      :::|::||.:.|:  :.|..   
 Worm   358 CGVENLVKLTLSICEDGLQRAAEATRKLGTPISSWS------LVVDLDGLSMRHL--WRPGV--- 411

  Fly   204 LLDYIQECICMRLKAVHIVNNSY--------------IFNMLFAVFKPFIREKLRKRIFF---HG 251
                  :|:   ||.:.||..:|              :|.:|:.:..|||.||.||:...   .|
 Worm   412 ------QCL---LKIIEIVEANYPETMGQVLVVRAPRVFPVLWTLISPFIDEKTRKKFMVSGGSG 467

  Fly   252 KDYK-SLISHIEAKALPPKYGGS 273
            .|.| .|..|||.|.:|...|||
 Worm   468 GDLKEELRKHIEEKFIPDFLGGS 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 9/44 (20%)
SEC14 116..272 CDD:238099 45/207 (22%)
T23G5.2NP_001040875.1 PRELI 17..170 CDD:282550
CRAL_TRIO_N 256..297 CDD:215024 10/45 (22%)
SEC14 320..491 CDD:214706 46/197 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.