DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and H41C03.1

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_495168.1 Gene:H41C03.1 / 173994 WormBaseID:WBGene00019268 Length:396 Species:Caenorhabditis elegans


Alignment Length:243 Identity:46/243 - (18%)
Similarity:90/243 - (37%) Gaps:75/243 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 THYY----------------PESALKRLKNFYHMKLKYGAACENIIPSK-----LRNVFEANILN 126
            |.||                .:.||..|:.  |::.:.....:||:.:.     |:..|...::.
 Worm    21 TEYYDTDFNLLRWAQGYGFDKDEALAELRR--HLRFRQYYDLDNILTNVPDHPILKKYFPLGLVG 83

  Fly   127 LLPQRDQHGRRLLVLE-AGKKWKPSQVPLVDLFRGIQLT---------------VLGSMVEPYSQ 175
            ...:.:|    |||:| ||:      :.|:.:.:.:.|:               .:..|...|..
 Worm    84 ETGKDNQ----LLVIECAGR------IDLMGILKSVHLSDFLIQRFKFQEKMLAAMNEMERKYGT 138

  Fly   176 ICGSVVIIDMEGLPLSHITQFTPS------------FAAMLLDYIQECICMRLKAVHIVNNSYIF 228
            .|..:.|:|:|||      :|.|:            :|::...|.:     .:..:.::|.....
 Worm   139 QCSVIYILDLEGL------KFDPALISIVTGPYRILWASVYTAYPE-----WINTLFLINAPSFM 192

  Fly   229 NMLFAVFKPFIREKLRK--RIFFHGKDYK-SLISHIEAKALPPKYGGS 273
            .:|:....|.:.|:.|.  ||.....|:| |:..|.....:|..:||:
 Worm   193 TLLWKAIGPLLPERTRNKVRICSGNSDWKTSVQKHAHIDNIPKHWGGT 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 6/28 (21%)
SEC14 116..272 CDD:238099 35/186 (19%)
H41C03.1NP_495168.1 SEC14 69..242 CDD:214706 37/193 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.