DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and CLVS1

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_775790.1 Gene:CLVS1 / 157807 HGNCID:23139 Length:354 Species:Homo sapiens


Alignment Length:287 Identity:83/287 - (28%)
Similarity:139/287 - (48%) Gaps:29/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 APEWALKKAQDELREVPGVKEQAIKELRELIQNEKYLN-LPLDDEYMMMFLRPTHYYPESALKRL 94
            :|| .::||:.||.|.|.|..|.|:::|::|.....:. |..||.:::.|||...::...|.:.|
Human    31 SPE-TIEKARLELNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLL 94

  Fly    95 KNFYHMK------LKYGAACENIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQVP 153
            ..::..:      .|...|.:..|...|.:.|.    .:|..||.:||::|:|.|. .|..|:..
Human    95 AQYFQYRQLNLDMFKNFKADDPGIKRALIDGFP----GVLENRDHYGRKILLLFAA-NWDQSRNS 154

  Fly   154 LVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKA 218
            ..|:.|.|.|::...:.:|..||.|.::|||.........::.|||...:.::.:|:....|...
Human   155 FTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGG 219

  Fly   219 VHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGS------ATWE 277
            ||.||..:..:.|:.:.|||:::|.|||||.||.:..||...|..:.||.::||:      .||.
Human   220 VHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMGTWA 284

  Fly   278 LPHGKVLGEFFECYSKDYELADSYGYT 304
               ..:||       .||...:.|.:|
Human   285 ---RTLLG-------PDYSDENDYTHT 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/45 (27%)
SEC14 116..272 CDD:238099 49/155 (32%)
CLVS1NP_775790.1 CRAL_TRIO_N 51..97 CDD:215024 12/45 (27%)
CRAL_TRIO 125..274 CDD:306996 49/153 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59833
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8539
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.