DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and CLVS2

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens


Alignment Length:288 Identity:88/288 - (30%)
Similarity:139/288 - (48%) Gaps:32/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 APEWALKKAQDELREVPGVKEQAIKELRELIQNEKYLN-LPLDDEYMMMFLRPTHYYPESALKRL 94
            :|| .|:||:.||.|.|....|.|:|:|:::.....:. |..||.:::.|||...::...|.:.|
Human     9 SPE-TLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLL 72

  Fly    95 KNFYHMK------LKYGAACENIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQVP 153
            ..::..:      .|...|.:..|...|::.|...:.||    |.:||::|||.|. .|..|:..
Human    73 AQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGGLANL----DHYGRKILVLFAA-NWDQSRYT 132

  Fly   154 LVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKA 218
            |||:.|.|.|::...:.:|..|:.|.|:|||.........::.|||...:.::.:|:....|...
Human   133 LVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGG 197

  Fly   219 VHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGG------SATWE 277
            :|.||..:..:.|:.|.:||::||.|||||.||.:..||...|..:.||.::||      ..||.
Human   198 IHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDMGTWA 262

  Fly   278 ---LPHGKVLGEFFECYSKDYEL-ADSY 301
               |.|.         |..|.|. .|||
Human   263 RTLLDHE---------YDDDSEYNVDSY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/45 (27%)
SEC14 116..272 CDD:238099 52/155 (34%)
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 12/45 (27%)
SEC14 106..251 CDD:238099 50/149 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59833
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8539
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.