DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and LOC1274486

DIOPT Version :10

Sequence 1:NP_609120.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_061502798.1 Gene:LOC1274486 / 1274486 VectorBaseID:AGAMI1_000308 Length:345 Species:Anopheles gambiae


Alignment Length:127 Identity:26/127 - (20%)
Similarity:50/127 - (39%) Gaps:43/127 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1012 LERKSRHSQF-----------LIQKVDKHLEGIGKMQDRTGELVESVRQLPKELSTTADQTTIAT 1065
            |:||..|.||           :...:::.|:..|      ||.:|...|:.|.|:..        
Mosquito     4 LQRKLVHKQFNSPMGLYSQENVKATLNRELKAFG------GEGIEVDDQITKPLNLA-------- 54

  Fly  1066 VRALRETIEKDMRGLHASLLRSVREHIRQEIEKGFE--AQASSLEDSVLSVVRSQAQTPAPS 1125
                           ::::||:|.|. .|:.:.|::  |...:.|:.::.....|.||.:|:
Mosquito    55 ---------------NSAVLRAVEEE-EQQAKCGYKRVAWPPASEERIIREFTPQPQTQSPA 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_609120.1 CRAL_TRIO_N 51..96 CDD:215024
SEC14 121..273 CDD:469559
LOC1274486XP_061502798.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.