DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and Sec14l2

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_446253.2 Gene:Sec14l2 / 116486 RGDID:621779 Length:403 Species:Rattus norvegicus


Alignment Length:272 Identity:65/272 - (23%)
Similarity:115/272 - (42%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KEQAIKELRELIQNEKYLNLPL----DDEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGAACEN 110
            :|:|:.:.||.:|:.    ||.    ||.:::.:||...:..:.:...|:.  |::.:.....:.
  Rat    12 QEEALAKFRENVQDV----LPALPNPDDYFLLRWLRARSFDLQKSEAMLRK--HVEFRKQKDIDK 70

  Fly   111 IIPSKLRNVFEANI---------------LNLLPQRDQHGRRLLVLEAGK------KWKPSQVPL 154
            ||..:...|.:..:               .:::...|..|   |:..|.|      |.:..::.|
  Rat    71 IISWQPPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKG---LLFSASKQDLLRTKMRDCELLL 132

  Fly   155 VDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAM--LLDYIQECICMRLK 217
            .:...  |...||..:|..:      :|.|.|||.|.|:  :.|:..|.  .|...:|.....||
  Rat   133 QECTH--QTAKLGKKIETIT------MIYDCEGLGLKHL--WKPAVEAYGEFLTMFEENYPETLK 187

  Fly   218 AVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKS-LISHIEAKALPPKYGGSATWELPHG 281
            .:.:|....:|.:.:.:.|||:.|..||:|...|.::|. |:.||....||.:|||:.|  .|.|
  Rat   188 RLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQLPVEYGGTMT--DPDG 250

  Fly   282 KVLGEFFECYSK 293
            ..     :|.||
  Rat   251 NP-----KCKSK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/48 (25%)
SEC14 116..272 CDD:238099 42/179 (23%)
Sec14l2NP_446253.2 CRAL_TRIO_N 13..59 CDD:215024 12/51 (24%)
SEC14 76..244 CDD:214706 43/180 (24%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.