DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and LOC110439320

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_021330480.1 Gene:LOC110439320 / 110439320 -ID:- Length:230 Species:Danio rerio


Alignment Length:30 Identity:8/30 - (26%)
Similarity:17/30 - (56%) Gaps:1/30 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 EPYSQICGSVVIIDMEGLPLSHITQFTPSF 200
            :.||.:..::...:.|.:..||:|:: |.|
Zfish   118 QDYSMVETALTCREGESVQGSHVTRW-PGF 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024
SEC14 116..272 CDD:238099 8/30 (27%)
LOC110439320XP_021330480.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.