DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and si:dkey-237i9.1

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_021332743.1 Gene:si:dkey-237i9.1 / 100535835 ZFINID:ZDB-GENE-060503-441 Length:719 Species:Danio rerio


Alignment Length:331 Identity:73/331 - (22%)
Similarity:126/331 - (38%) Gaps:88/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PEWAL------KKAQDELR-----------EVPGV---KEQAIKELRELIQ--NEKYLNLP---L 71
            |.|::      |..:..:|           |||.|   ..|..||....:.  |:..:..|   |
Zfish   179 PRWSVCPSSPTKSMKPVVRPELHLIPTVTIEVPPVCMNDTQVCKETSNPLSSLNDTLIASPDDKL 243

  Fly    72 DDEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGAACENIIPSKLR----NVFEAN--ILNLLPQ 130
            |.:|:..:|.......||.|.||:::.....|.....:..|...||    |:.:|.  :...|..
Zfish   244 DADYIKRYLGDLTPLQESCLIRLRHWLQETHKGKIPKDEHILRFLRARDFNIDKAREILCQSLTW 308

  Fly   131 RDQHGRRLLVLEAGKKWKPSQVPLVDLFRG-----------IQLTVLGSM--------------- 169
            |.||....|:    ..|...|| |.|.:.|           :.:..||.|               
Zfish   309 RKQHQVDYLL----DTWSSPQV-LHDFYTGGWHHHDNDGRPLYILRLGHMDTKGLVRALGEESLL 368

  Fly   170 -------------VEPYSQICGSVV-----IIDMEGLPLSHITQFTPSFAAML--LDYIQECICM 214
                         .|..:::.|..:     ::|:|||.:.|:  :.|:..|:|  ::.::.....
Zfish   369 RHVLSINEEGLRRCEENTKVFGRPISCWTCLVDLEGLNMRHL--WRPAVKALLRIIEVVEANYPE 431

  Fly   215 RLKAVHIVNNSYIFNMLFAVFKPFIREKLRKR-IFFHGKDYK---SLISHIEAKALPPKYGGSAT 275
            .|..:.|:....:|.:|:.:..|||.|..||: :.:.|.||:   .|:.:|:.:.:|...||...
Zfish   432 TLGRLLILRAPRVFPVLWTLVSPFIDENTRKKFLIYAGNDYQGSGGLVDYIDKEVIPDFLGGECM 496

  Fly   276 WELPHG 281
            .|:|.|
Zfish   497 CEVPEG 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 14/49 (29%)
SEC14 116..272 CDD:238099 44/211 (21%)
si:dkey-237i9.1XP_021332743.1 PRELI 17..173 CDD:309720
CRAL_TRIO_N 260..305 CDD:215024 11/44 (25%)
CRAL_TRIO 331..494 CDD:306996 31/164 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.