DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5973 and clvs1

DIOPT Version :9

Sequence 1:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_012819596.1 Gene:clvs1 / 100037913 XenbaseID:XB-GENE-5740434 Length:332 Species:Xenopus tropicalis


Alignment Length:259 Identity:75/259 - (28%)
Similarity:127/259 - (49%) Gaps:19/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 APEWALKKAQDELREVPGVKEQAIKELRELIQNEKYLN-LPLDDEYMMMFLRPTHYYPESALKRL 94
            :|| .::|::.||.|.|....|.|:::|::|.....:. |..||.:::.|||...:....|.:.|
 Frog     9 SPE-TIEKSRLELNENPDTLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFNQMEAFRLL 72

  Fly    95 KNFYHMK------LKYGAACENIIPSKLRNVFEANILNLLPQRDQHGRRLLVLEAGKKWKPSQVP 153
            ..::..:      .|...|.:..|...|.:.|.    .:|..||.:||::|:|.|. .|..|:..
 Frog    73 AQYFQYRQLNLDMFKNLKADDPGIKRALMDGFP----GVLENRDHYGRKILLLFAA-NWDQSRNS 132

  Fly   154 LVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKA 218
            .||:.|.|.|::...:.:...||.|.::|||.........::.|||...:.::.:|:....|...
 Frog   133 FVDILRAILLSLEVLIEDQELQINGFILIIDWSNFSFKQASKLTPSILRLAIEGLQDSFPARFGG 197

  Fly   219 VHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGS------ATW 276
            ||.||..:..:.|:.:.|||:::|.|||||.||.:..||...|....||.::||:      .||
 Frog   198 VHFVNQPWYIHALYTIIKPFLKDKTRKRIFLHGNNLNSLHQLIHPDCLPSEFGGTLPPYDMGTW 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/45 (27%)
SEC14 116..272 CDD:238099 49/155 (32%)
clvs1XP_012819596.1 CRAL_TRIO_N 29..75 CDD:215024 12/45 (27%)
SEC14 106..252 CDD:238099 48/146 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59833
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9431
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.