DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and SEC14

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:257 Identity:65/257 - (25%)
Similarity:111/257 - (43%) Gaps:50/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMKTTASFRKEYASLVRGL 98
            :..:.:|:.:||:||:....:...||...|. ||||..|..:.|.|..:....:||:|.:     
Yeast    30 DSAQEKALAELRKLLEDAGFIERLDDSTLLR-FLRARKFDVQLAKEMFENCEKWRKDYGT----- 88

  Fly    99 LVEQVKEKFVKGSVINVLK-------NCDQKGRRVLIVNCG--KLWDPSDITSDEMFRMLYMVHL 154
              :.:.:.|.......:.|       ..|:.||.|.....|  .|.:.:.:||:|  |||  .:|
Yeast    89 --DTILQDFHYDEKPLIAKFYPQYYHKTDKDGRPVYFEELGAVNLHEMNKVTSEE--RML--KNL 147

  Fly   155 AAQLEEETQVRGVVC-------------IMDFEGLSMKQVKALSPSFSKRLLTFIQEA------- 199
            ..:.|...|.|...|             |||.:|:|      :|.::|  ::::::||       
Yeast   148 VWEYESVVQYRLPACSRAAGHLVETSCTIMDLKGIS------ISSAYS--VMSYVREASYISQNY 204

  Fly   200 MPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSD-MKSLQKFLDPSVLPANYKG 260
            .|.||.:.:.:..||.|:..:.|||||:.....:::...||. .|.|.|.:....||..:.|
Yeast   205 YPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGSSYQKELLKQIPAENLPVKFGG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 15/43 (35%)
CRAL_TRIO 111..261 CDD:279044 46/180 (26%)
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 15/45 (33%)
SEC14 99..269 CDD:214706 46/180 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.