DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and YKL091C

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_012832.1 Gene:YKL091C / 853771 SGDID:S000001574 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:265 Identity:65/265 - (24%)
Similarity:113/265 - (42%) Gaps:57/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TEEVKAEAIIKLRELLKATPELNYKD--DDAFLTVFLRACHFYPEGALEKMKTTASFRKEYASLV 95
            |:| :.||:::.|.:|.   |.|||:  ||:.|..||||..|....::|....|..:|:||.:  
Yeast    26 TKE-QEEALLQFRSILL---EKNYKERLDDSTLLRFLRARKFDINASVEMFVETERWREEYGA-- 84

  Fly    96 RGLLVE--------QVKEKFVKGSVINVLK-------NCDQKGRRVLI-----VNCGKLWDPSDI 140
             ..::|        :.||:      |.:.|       :.|:.||.:..     :|..|::..:  
Yeast    85 -NTIIEDYENNKEAEDKER------IKLAKMYPQYYHHVDKDGRPLYFEELGGINLKKMYKIT-- 140

  Fly   141 TSDEMFRMLYMVHLAAQLEEETQVRGVVC-------------IMDFEGLSMKQVKALSPSFSKRL 192
            |..:|.|     :|..:.|.....|...|             ::|.:|:|:.....:. |:.|.:
Yeast   141 TEKQMLR-----NLVKEYELFATYRVPACSRRAGYLIETSCTVLDLKGISLSNAYHVL-SYIKDV 199

  Fly   193 LTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSD-MKSLQKFLDPSVLPA 256
            ....|...|.||.:.:.:..||.|:.::.:.|||:.....:::...||. .|.|.|.:....||.
Yeast   200 ADISQNYYPERMGKFYIIHSPFGFSTMFKMVKPFLDPVTVSKIFILGSSYKKELLKQIPIENLPV 264

  Fly   257 NYKGT 261
            .|.||
Yeast   265 KYGGT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 17/45 (38%)
CRAL_TRIO 111..261 CDD:279044 37/175 (21%)
YKL091CNP_012832.1 CRAL_TRIO_N 30..75 CDD:215024 17/47 (36%)
SEC14 101..271 CDD:214706 40/183 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.