DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and SFH5

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:281 Identity:62/281 - (22%)
Similarity:100/281 - (35%) Gaps:82/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GY-LKPETVEIARVELRETEEVKAEAIIKL------------RELLKATPELNYKDDDAFLTVFL 67
            || |.||.:....|:....|::......||            :.|:..   ||::.:...|:...
Yeast    35 GYKLNPEGLTQEEVDKYYDEKIADRLTYKLCKAYQFEYSTIVQNLIDI---LNWRREFNPLSCAY 96

  Fly    68 RACH-----------FYPEGALEKMKTTASFRKEYASLVRGLLVEQVKEKFVKGSVINVLKNCDQ 121
            :..|           |...|...|...|.:.   |..||:...:.|..:|||:..:     ...:
Yeast    97 KEVHNTELQNVGILTFDANGDANKKAVTWNL---YGQLVKKKELFQNVDKFVRYRI-----GLME 153

  Fly   122 KGRRVLIVNCGKLWDPSDITSDEMFRMLYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSP 186
            ||..:|           |.||.:...|             |||.      |::|:|:.::.:...
Yeast   154 KGLSLL-----------DFTSSDNNYM-------------TQVH------DYKGVSVWRMDSDIK 188

  Fly   187 SFSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFL-- 249
            :.||.::...|:..|..:...:||..|.:|..|:.|.|.||             |..:.:||:  
Yeast   189 NCSKTVIGIFQKYYPELLYAKYFVNVPTVFGWVYDLIKKFV-------------DETTRKKFVVL 240

  Fly   250 -DPSVLPANYKGTLPAIDYGG 269
             |.|.| ..|....|...|||
Yeast   241 TDGSKL-GQYLKDCPYEGYGG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 10/66 (15%)
CRAL_TRIO 111..261 CDD:279044 33/152 (22%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 48/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.