DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and AT1G75170

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001031283.1 Gene:AT1G75170 / 843854 AraportID:AT1G75170 Length:296 Species:Arabidopsis thaliana


Alignment Length:247 Identity:55/247 - (22%)
Similarity:108/247 - (43%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ETEEVKAEAII---KLRELLKATPELNYKD----DDAFLTVFLRACHFYPEGALEKMKTTASFRK 89
            :||:.:.||.:   |::||.....:|:.::    .||.|..:|.|.::....|.:.::.|..:|.
plant     9 QTEQEQKEAALREAKMKELKTLIGQLSGRNSLYCSDACLKRYLEARNWNVGKAKKMLEETLKWRS 73

  Fly    90 EYASLVRGLLVEQVK--EKFVKGSVINVLKN--CDQKGRRVLIVNCGKLWDPSDITSDEMFRMLY 150
            .:..       |:::  |...:|....|.|.  .|:.||.|||:..| |.:...: .::|..::|
plant    74 SFKP-------EEIRWNEVSGEGETGKVYKAGFHDRHGRTVLILRPG-LQNTKSL-ENQMKHLVY 129

  Fly   151 MVHLAAQLEEETQVRGVVCIMDFEGLSMK---QVKALSPSFSKRLLTFIQEAMPLRMKEVHFVKQ 212
            ::..|.....|.|.: :..::||.|.||.   .:|:     ::..:..:|...|.|:........
plant   130 LIENAILNLPEDQEQ-MSWLIDFTGWSMSTSVPIKS-----ARETINILQNHYPERLAVAFLYNP 188

  Fly   213 PFIFNMVWSLFKPFVKQKLNNRMHF----HGSDMKSLQKFLDPSVLPANYKG 260
            |.:|...|.:.|.|:..|...::.|    :...::.:..|.|...||..:.|
plant   189 PRLFEAFWKIVKYFIDAKTFVKVKFVYPKNSESVELMSTFFDEENLPTEFGG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 12/50 (24%)
CRAL_TRIO 111..261 CDD:279044 36/159 (23%)
AT1G75170NP_001031283.1 CRAL_TRIO_N 21..68 CDD:215024 10/46 (22%)
SEC14 98..241 CDD:238099 34/151 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.