DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and AT1G22180

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001322892.1 Gene:AT1G22180 / 838823 AraportID:AT1G22180 Length:314 Species:Arabidopsis thaliana


Alignment Length:237 Identity:59/237 - (24%)
Similarity:99/237 - (41%) Gaps:22/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TEEVKAEAIIKLRELLKATPELNYK-DDDAFLTVFLRACHFYPEGALEKMKTTASFRKEYASLVR 96
            |.|.....|.::|.||....|.:.: ..||.:|.:|.|.:.:.:.|.:.:|.|..:|.:|..  .
plant    18 TPEEYLNKINEVRTLLGPLTEKSSEFCSDAAITRYLAARNGHVKKATKMLKETLKWRAQYKP--E 80

  Fly    97 GLLVEQVKEKFVKGSVINVLKNC-DQKGRRVLIVNCGKLWDPSDITSDE---MFRMLYMVHLAAQ 157
            .:..|::..:...|.:...  || |:.||.||::.      ||...:..   ..|:|......|.
plant    81 EIRWEEIAREAETGKIYRA--NCTDKYGRTVLVMR------PSCQNTKSYKGQIRILVYCMENAI 137

  Fly   158 LEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSL 222
            |........:|.::||.|.:|..:   |...|:.....:||..|.|:........|.||...:.:
plant   138 LNLPDNQEQMVWLIDFHGFNMSHI---SLKVSRETAHVLQEHYPERLGLAIVYNPPKIFESFYKM 199

  Fly   223 FKPFVKQKLNNRMHFHGSD----MKSLQKFLDPSVLPANYKG 260
            .|||::.|.:|::.|..||    .|.|:...|...|...:.|
plant   200 VKPFLEPKTSNKVKFVYSDDNLSNKLLEDLFDMEQLEVAFGG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 11/44 (25%)
CRAL_TRIO 111..261 CDD:279044 40/158 (25%)
AT1G22180NP_001322892.1 CRAL_TRIO_N 25..70 CDD:215024 12/44 (27%)
SEC14 90..243 CDD:214706 41/163 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.