DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and AT1G05370

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_172029.2 Gene:AT1G05370 / 837038 AraportID:AT1G05370 Length:417 Species:Arabidopsis thaliana


Alignment Length:202 Identity:41/202 - (20%)
Similarity:83/202 - (41%) Gaps:29/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KAEAIIKLRELLKATPELNYKDDD----AFLTVFLRACHFYPEGALEKMKTTASFRKEYASLVRG 97
            |.||::.|  |.|.:| |..|.:.    |.:..|||......:.|.:::::..|:|....  :..
plant    18 KVEAVLHL--LRKHSP-LTLKQEKFCNRACVGRFLRIKGDNVKKAAKQLRSCLSWRSSLG--IES 77

  Fly    98 LLVEQVKEKFVKGSVINVLKNCDQKGRRVLIV----NCGKLWDPSDITSDEMFRMLYMVHLAAQL 158
            |:.::...:..:|  :..:...|.:.|.||:.    :..||.....:|...:|.:...:...::.
plant    78 LIADEFTAELAEG--LAYVAGLDDECRPVLVFRIKQDYQKLHTQKQLTRLVVFTLEVAISTMSRN 140

  Fly   159 EEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLT---FIQEAMPLRMKEVHFVKQPFIFNMVW 220
            .|:       .::.|:....|...|    |...|:|   .:.|..|.|:.:...:..|.:|:.:|
plant   141 VEQ-------FVILFDASFFKSASA----FMNILVTTLKIVAEYYPCRLFKTFVIDPPSLFSYLW 194

  Fly   221 SLFKPFV 227
            ...:.||
plant   195 KGIRTFV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 13/47 (28%)
CRAL_TRIO 111..261 CDD:279044 23/124 (19%)
AT1G05370NP_172029.2 SEC14 89..219 CDD:238099 24/126 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.