DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and AT4G36640

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001329225.1 Gene:AT4G36640 / 829816 AraportID:AT4G36640 Length:294 Species:Arabidopsis thaliana


Alignment Length:264 Identity:62/264 - (23%)
Similarity:110/264 - (41%) Gaps:52/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KLRELLKATPELNYKD----DDAFLTVFLRACHFYPEGALEKMKTTASFRKEYASLVRGLLVEQV 103
            |:|||..|...|:...    .||.|..||.|.::..|.|.:.::.|..:|..|..  :.:...||
plant    20 KVRELKSAIGPLSGHSLVFCSDASLRRFLDARNWDVEKAKKMIQETLKWRSTYKP--QEIRWNQV 82

  Fly   104 KEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDPS--DITSDE--MFRMLYMVHLAAQLEEETQV 164
            ..:...|.......: |::||.|||:.      |:  :.||.|  :..::|::..|.....:.| 
plant    83 AHEGETGKASRASFH-DRQGRVVLIMR------PAMQNSTSQEGNIRHLVYLLENAIINLPKGQ- 139

  Fly   165 RGVVCIMDFEGLSMKQVKALSPSF--SKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFV 227
            :.:..::||.|.||    |::|..  ::.::..:|...|.|:........|.:|..|:...|.|:
plant   140 KQMSWLIDFTGWSM----AVNPPMKTTREIIHILQNYYPERLGIAFLYNPPRLFQAVYRAAKYFL 200

  Fly   228 -------------KQKLNNRM---HFHGSDMKSLQK-FLDPSVLPAN--------YKGTLPAIDY 267
                         |.|.::.:   ||   |:::|.| |...:.|..:        |:..|....|
plant   201 DPRTAEKVKFVYPKDKASDELMTTHF---DVENLPKEFGGEATLEYDHEDFSRQMYEDDLKTAKY 262

  Fly   268 GGVE 271
            .|:|
plant   263 WGLE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 14/42 (33%)
CRAL_TRIO 111..261 CDD:279044 38/180 (21%)
AT4G36640NP_001329225.1 CRAL_TRIO_N 20..65 CDD:215024 14/44 (32%)
SEC14 85..238 CDD:214706 37/167 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.