DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and AT4G08690

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001031598.1 Gene:AT4G08690 / 826436 AraportID:AT4G08690 Length:301 Species:Arabidopsis thaliana


Alignment Length:264 Identity:68/264 - (25%)
Similarity:119/264 - (45%) Gaps:44/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GYLKPETVEIARVELRETEEVKAEAIIKLRELLKATPE--LNYKDDDAFLTVFLRACHFYPEGAL 78
            |::||.          .|||.:|: |.::|:||...||  .::..|||.|. :|||.:::.:.|.
plant     9 GFVKPV----------PTEEEQAK-IEEVRKLLGPLPEKLSSFCSDDAVLR-YLRARNWHVKKAT 61

  Fly    79 EKMKTTASFRKEYASLVRGLLVEQVKEKFVKGSVINVLKNC-DQKGRRVLIVNCGKLWDPSDITS 142
            :.:|.|..:|.:|..  ..:..|:|..:...|.:..  .:| |:.||.|||:....  :.|....
plant    62 KMLKETLKWRVQYKP--EEICWEEVAGEAETGKIYR--SSCVDKLGRPVLIMRPSV--ENSKSVK 120

  Fly   143 DEMFRMLYMVHLAAQL----EEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLR 203
            .::..::|.:..|.|.    ||:     :|.::||.|.|:..|   |...:|.....:||..|.|
plant   121 GQIRYLVYCMENAVQNLPPGEEQ-----MVWMIDFHGYSLANV---SLRTTKETAHVLQEHYPER 177

  Fly   204 MKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPS---VLPANYKGTLPAI 265
            :........|..|...|.:.:||::.|..|::.|..||        ||:   ::..|:......:
plant   178 LAFAVLYNPPKFFEPFWKVARPFLEPKTRNKVKFVYSD--------DPNTKVIMEENFDMEKMEL 234

  Fly   266 DYGG 269
            .:||
plant   235 AFGG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 15/45 (33%)
CRAL_TRIO 111..261 CDD:279044 38/157 (24%)
AT4G08690NP_001031598.1 CRAL_TRIO_N 20..67 CDD:215024 16/48 (33%)
SEC14 87..241 CDD:214706 41/172 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.