DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and AT3G22410

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_188880.1 Gene:AT3G22410 / 821809 AraportID:AT3G22410 Length:400 Species:Arabidopsis thaliana


Alignment Length:216 Identity:41/216 - (18%)
Similarity:83/216 - (38%) Gaps:48/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EEVKAEAIIKLRELLKATPELNYKDD--------DAFLTVFLRACHFYPEG-----ALEKMKTTA 85
            ::.|.||:::   |:|....|.:|.:        :.||.|         :|     |.:::.:..
plant     4 KDEKVEAVLR---LVKKQSPLTFKQEKFCNRECVERFLKV---------KGDNVKKAAKQLSSCL 56

  Fly    86 SFRKEYASLVRGLLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDPSDITSDEMFRML- 149
            |:|:.:.  :..|..|:...:...|  :..:...|::.|.|:|.....  |...:.:.:.|..| 
plant    57 SWRQNFD--IERLGAEEFSTELSDG--VAYISGHDRESRPVIIFRFKH--DYQKLHTQKQFTRLV 115

  Fly   150 -YMVHLAAQLEEETQVRGVVCIMD---FEGLSMKQVKALSPSFSKRLLT---FIQEAMPLRMKEV 207
             :.:..|.........:..|.:.|   |..         |.:|:..||.   .|.:..|.|:.:.
plant   116 AFTIETAISSMSRNTEQSFVLLFDASFFRS---------SSAFANLLLATLKIIADNYPCRLYKA 171

  Fly   208 HFVKQPFIFNMVWSLFKPFVK 228
            ..:..|..|:.:|...:|||:
plant   172 FIIDPPSFFSYLWKGVRPFVE 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 11/56 (20%)
CRAL_TRIO 111..261 CDD:279044 24/126 (19%)
AT3G22410NP_188880.1 SEC14 78..209 CDD:238099 25/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.