DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and Sec14l1

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:253 Identity:57/253 - (22%)
Similarity:115/253 - (45%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMKTTASFRKEYASL 94
            |.:...::...:|:||:.|:.|.:.....|:..|. ||||..|..:.|.|.|..:.::||::.  
Mouse   248 LGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILR-FLRARDFNIDKAREIMCQSLTWRKQHQ-- 309

  Fly    95 VRGLLVEQVKEKFVKGSVI-----NVLKNCDQKGRRVLIVNCGKLWDPSDIT----SDEMFRMLY 150
                 |:.:.:.:....|:     ....:.|:.||.:.::..|:: |...:.    .:.:.|.:.
Mouse   310 -----VDYILDTWTPPQVLLDYYAGGWHHHDKDGRPLYVLRLGQM-DTKGLVRALGEEALLRYVL 368

  Fly   151 MVHLAA--QLEEETQVRG-----VVCIMDFEGLSMKQ-----VKALSPSFSKRLLTFIQEAMPLR 203
            .::...  :.||.|:|.|     ..|::|.|||:|:.     ||||     .|::..::...|..
Mouse   369 SINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKAL-----LRIIEVVEANYPET 428

  Fly   204 MKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHF---HGSDMK---SLQKFLDPSVLP 255
            :..:..::.|.:|.::|:|..||:..  |.|..|   .|:|.:   .|..::|..::|
Mouse   429 LGRLLILRAPRVFPVLWTLVSPFIDD--NTRRKFLIYAGNDYQGPGGLLDYIDKEIIP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 14/43 (33%)
CRAL_TRIO 111..261 CDD:279044 38/172 (22%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 57/253 (23%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 15/45 (33%)
CRAL_TRIO 326..490 CDD:279044 37/167 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.