DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and SEC14L6

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_016884420.1 Gene:SEC14L6 / 730005 HGNCID:40047 Length:432 Species:Homo sapiens


Alignment Length:328 Identity:62/328 - (18%)
Similarity:121/328 - (36%) Gaps:109/328 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RLGYLKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGAL 78
            ::|.|.| :.|.:..:.||          .::::|.|.|    ..||.||..:|:|..|..:.:.
Human     7 QVGDLSP-SQEKSLAQFRE----------NIQDVLSALP----NPDDYFLLRWLQARSFDLQKSE 56

  Fly    79 EKMKTTASFRK--EYASLV------------------------------------RGLLVEQVKE 105
            :.::....|||  :.|:::                                    :|||:...|:
Human    57 DMLRKHMEFRKQQDLANILAWQPPEVVRLYNANGICGHDGEGSPVWYHIVGSLDPKGLLLSASKQ 121

  Fly   106 KFVKGSVIN---VLKNC-------------------DQKGRRVLIVNCG-KLWDPSDITSDEMFR 147
            :.::.|..:   :|:.|                   |::|      ||. .:|.|.|        
Human   122 ELLRDSFRSCELLLRECELQSQKPHWTRGTGISAPLDRRG------NCNTAIWPPMD-------- 172

  Fly   148 MLYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMKEVHFVKQ 212
                    ...|...:|..::.|...|||.::.:........:...:.::...|..:|.:..|:.
Human   173 --------RHKELGKRVEKIIAIFGLEGLGLRDLWKPGIELLQEFFSALEANYPEILKSLIVVRA 229

  Fly   213 PFIFNMVWSLFKPFVKQKLNNRMHFHGSDMK-SLQKFLDPSVLPANYKGT----------LPAID 266
            |.:|.:.::|.|.::.::...::...|.:.| .|.||:.|..||..:.||          |..|:
Human   230 PKLFAVAFNLVKSYMSEETRRKVVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKIN 294

  Fly   267 YGG 269
            |||
Human   295 YGG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 10/43 (23%)
CRAL_TRIO 111..261 CDD:279044 31/173 (18%)
SEC14L6XP_016884420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.