DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and TTPA

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_000361.1 Gene:TTPA / 7274 HGNCID:12404 Length:278 Species:Homo sapiens


Alignment Length:238 Identity:72/238 - (30%)
Similarity:117/238 - (49%) Gaps:36/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DAFLTVFLRACHFYPEGALEKMKTTASFRKEYASL--------VRGLLVEQVKEKFVKGSVINVL 116
            |:||..||||..|..:.|...:|....:|.|...:        :.|||         |.....||
Human    49 DSFLLRFLRARDFDLDLAWRLLKNY
YKWRAECPEISADLHPRSIIGLL---------KAGYHGVL 104

  Fly   117 KNCDQKGRRVLIVNCGKLWDPSDITSDEMFRMLYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQV 181
            ::.|..|.:|||..... |||...|:.::||:..:.......|.|||..|:..|.|.||......
Human   105 RSRDPTGSKVLIYRIAH-WDPKVFTAYDVFRVSLITSELIVQEVETQRNGIKAIFDLEGWQFSHA 168

  Fly   182 KALSPSFSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKS-- 244
            ..::||.:|::...:.::.||:::.:|.:.:|.||:.|:|:.|||:.:|:..|:|.||::.|.  
Human   169 FQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSL 233

  Fly   245 LQKFLDPSVLPANYKGTLPAIDYGGVEWFPALEQQAQYVEEWS 287
            ||.|  |.:||         ::|||.|:  ::|...|   ||:
Human   234 LQHF--PDILP---------LEYGGEEF--SMEDICQ---EWT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 9/21 (43%)
CRAL_TRIO 111..261 CDD:279044 48/151 (32%)
TTPANP_000361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
CRAL_TRIO_N <40..73 CDD:215024 10/23 (43%)
CRAL_TRIO 99..248 CDD:395525 50/160 (31%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.