DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and Sec14l2

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_653103.1 Gene:Sec14l2 / 67815 MGIID:1915065 Length:403 Species:Mus musculus


Alignment Length:338 Identity:75/338 - (22%)
Similarity:125/338 - (36%) Gaps:87/338 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RLGYLKPETVEIARVELRETEEVKAEAIIKLRE----LLKATPELNYKDDDAFLTVFLRACHFYP 74
            |:|.|.|:               :.||:.|.||    :|...|    ..||.||..:|||..|..
Mouse     4 RVGDLSPK---------------QEEALAKFRENVQDVLPTLP----NPDDYFLLRWLRARSFDL 49

  Fly    75 EGALEKMKTTASFR--KEYASLVRGLLVEQVKEKFVKGSVINVLKNC----------DQKGRRVL 127
            :.:...::....||  |:...::.....|.:::....|.....|..|          |.||   |
Mouse    50 QKSEAMLRKHVEFRKQKDIDKIISWQPPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKG---L 111

  Fly   128 IVNCGKLWDPSDITSDEM--FRMLYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSK 190
            :.:..|    .|:...:|  ..:|....:....:...::..:..|.|.|||.:|.:...:.....
Mouse   112 LFSASK----QDLLRTKMRDCELLLQECIQQTTKLGKKIETITMIYDCEGLGLKHLWKPAVEAYG 172

  Fly   191 RLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKS-LQKFLDPSVL 254
            ..||..:|..|..:|.:..||.|.:|.:.::|.|||:.:....::...|::.|. |.|.:.|..|
Mouse   173 EFLTMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRRKIMVLGANWKEVLLKHISPDQL 237

  Fly   255 PANYKGTL----------PAIDYGG-----------------------------VEW---FPALE 277
            |..|.||:          ..|:|||                             ||:   ||...
Mouse   238 PVEYGGTMTDPDGNPKCKSKINYGGDIPKQYYVRDQVKQQYEHTVQVSRGSSHQVEYEILFPGCV 302

  Fly   278 QQAQYVEEWSQLG 290
            .:.|::.|.|.:|
Mouse   303 LRWQFMSEGSDVG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 15/47 (32%)
CRAL_TRIO 111..261 CDD:279044 37/162 (23%)
Sec14l2NP_653103.1 CRAL_TRIO_N 13..59 CDD:215024 15/49 (31%)
SEC14 76..244 CDD:214706 39/174 (22%)
GOLD_2 300..381 CDD:290608 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.