DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and RLBP1

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:261 Identity:84/261 - (32%)
Similarity:140/261 - (53%) Gaps:15/261 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LKPETVEIARVELRETEEVKAEAIIKLRELLK-----------ATPELNYKDDDAFLTVFLRACH 71
            |...|::.|:.||.|.||.:.||:.:|:|:::           |..|...:.|..|...|:||..
Human    49 LPRHTLQKAKDELNEREETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARK 113

  Fly    72 FYPEGALEKMKTTASFRKEYASLVRGLLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWD 136
            |....|.|.::...:||.:|..|...|..|.|: ..::.....||.:.|:.||.|::.|. :.|.
Human   114 FNVGRAYELLRGYVNFRLQYPELFDSLSPEAVR-CTIEAGYPGVLSSRDKYGRVVMLFNI-ENWQ 176

  Fly   137 PSDITSDEMFRMLYMVHLAAQLE-EETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAM 200
            ..:||.||:.: .|...|...|| ||||:.|...|.:|:|.:|:|..:|..|..::::..:|::.
Human   177 SQEITFDEILQ-AYCFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSF 240

  Fly   201 PLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPANYKGTLPAI 265
            |.|.|.:||:.||:.|...:::.|||:|.||..|:..||.|:....:.:|.::||:::.||||..
Human   241 PARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKY 305

  Fly   266 D 266
            |
Human   306 D 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 14/54 (26%)
CRAL_TRIO 111..261 CDD:279044 50/150 (33%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68046
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 1 1.000 - - mtm8539
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10687
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.